PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016506626.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 185aa    MW: 21375.4 Da    PI: 10.3007
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016506626.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF55.57.4e-181656242
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    +ien+ nrqvtfsk rng++KKA+EL v+++aev +i+  +
  XP_016506626.1 16 KIENQNNRQVTFSKYRNGVFKKANELAVMTGAEVGIIVCPQ 56
                    79***********************************9755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.9E-21766IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.941767IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-15929IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-21977IPR002100Transcription factor, MADS-box
PfamPF003192.7E-191663IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-152944IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-154465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MSTRRITVRK SIRLAKIENQ NNRQVTFSKY RNGVFKKANE LAVMTGAEVG IIVCPQGSKP  60
YSFGHPNVNE TINKYVGEER PPSPSSPGID DEYVQMFRKA NSRELNTRFN SLQDQLVFAL  120
NMKSKLKKMN KKVESHQEWF KGPIEKMNYT EASMLKERLE DLLLKVKNYG TDRGYGYENG  180
KWKAE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016506626.11e-137PREDICTED: agamous-like MADS-box protein AGL62
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA3829435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.13e-22AGAMOUS-like 61